PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G000400.1.p
Common NameGLYMA_06G000400, LOC100798024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 582aa    MW: 64477.5 Da    PI: 6.8437
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G000400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.5e-29511562152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Glyma.06G000400.1.p 511 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 562
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.461501581IPR003035RWP-RK domain
PfamPF020422.5E-24515562IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MEYGGLVQNA YGSYGSFSDI LGPETDFIDE LFVEGCWLET RVGSYLNCGT EANSSKSNTM  60
RSMESTQIIF QQEESLPDPE ISLMVGKRWW IGPRENPGPS SSVKERLVIA VGYLKEYAKN  120
SNLPIQVWVP ERRSARAQPQ DNIYPYAAAL LNGDAAAFQI QEDWVHVNDQ YWTPNVRFFR  180
SHEYPRHLRT PGSLALPVFE RGTAMCLGVV EILMPNNPPD LQCTVDFTSS TSSHHHNFIP  240
PAVTVKGFDE LYQSALNGIV QVLTCVCKAH NLPLALTWAP CIQQAGKSGC GHSNDEMNYV  300
STVYAASFVA DVELMGFLEA CSECHLLGGQ GVVGTAFTTT KPCFANDITS FSKAEYPLAH  360
HANMFGLHAA LGIPLRSASA DFVLEFFLPK DCHDTQDQKQ LLNSLFMLVQ QACRSLHLVM  420
EEEEELIALP SVVGKEMESS SWIAHMMEAQ QKGKGVSVSL EYLQEPKQEF KVTTNCSNTN  480
EQVSVGVEST AAFCGRRVGR KSAGDKRRTK AEKTISLPVL RQYFAGSLKD AAKSIGVCPT  540
TLKRICRQHG ITRWPSRKIK KVKELLHSNP QQLRLAVRPL L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014632652.10.0PREDICTED: protein NLP2-like isoform X2
SwissprotQ7X9B91e-136NLP2_ARATH; Protein NLP2
TrEMBLK7KS910.0K7KS91_SOYBN; Uncharacterized protein
STRINGGLYMA06G00240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-136Nin-like family protein